PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0315200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 425aa    MW: 45631.4 Da    PI: 7.7337
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0315200.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-1793139148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+WT +Ede l++ v ++G + W+tIa+ ++ gR +kqc++rw ++l
  ORGLA01G0315200.1  93 KGAWTRQEDEVLKQMVILHGDRKWATIAKSLP-GRIGKQCRERWTNHL 139
                        79******************************.************996 PP

2Myb_DNA-binding55.51.3e-17145187145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        ++ WT+e+d  l++a+k +G++ W+ Iar+++ gR+++ +k++w+
  ORGLA01G0315200.1 145 KDVWTEEDDRTLIEAHKTYGNR-WSVIARCLP-GRSENAVKNHWN 187
                        578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.48288143IPR017930Myb domain
SuperFamilySSF466891.98E-2990186IPR009057Homeodomain-like
SMARTSM007177.8E-1692141IPR001005SANT/Myb domain
PfamPF002492.2E-1593139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2394144IPR009057Homeodomain-like
CDDcd001671.33E-1495139No hitNo description
SMARTSM007171.1E-17144192IPR001005SANT/Myb domain
PROSITE profilePS5129418.239144194IPR017930Myb domain
PfamPF002492.7E-15145187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-21145191IPR009057Homeodomain-like
CDDcd001671.67E-14148190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MMGSGMPHMY FASSSHGTGA HYQSPGGAPI TMAVPDMGFL VAGIGMAPSS FVMPEGALAA  60
SYSAMATVPV GVVVPQQQSS RFGGNNGNPG SFKGAWTRQE DEVLKQMVIL HGDRKWATIA  120
KSLPGRIGKQ CRERWTNHLR PDIKKDVWTE EDDRTLIEAH KTYGNRWSVI ARCLPGRSEN  180
AVKNHWNATK RSLKSKRRMK KKSVQVVNSP PGQLSPLEEY IRSQYPSAVE TTPPPPAVPA  240
PPSDVIVHGA GSVSAGPTVA TQEPTGTNPS EMGIYLGLGN PAGPTTQQLA AMNLNMSLAP  300
DLNAYNDQRE GYYLPFVPQG NLHYGMHVPA PPVQQQQQQG ISVDQGLHSS CLSLYHPFPG  360
THPVSLDFGC QSSNHANAGG YYSEAGPSSG SGSGDPDDVD VIQMASRQFL MPSEAEVTLD  420
LTRFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-42871951110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2879950.0AK287995.1 Oryza sativa Japonica Group cDNA, clone: J075101C16, full insert sequence.
GenBankFJ9402150.0FJ940215.1 Oryza sativa Japonica Group clone KCS005D12 Myb protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645142.10.0PREDICTED: uncharacterized protein LOC4324828
TrEMBLA0A0D3EWF00.0A0A0D3EWF0_9ORYZ; Uncharacterized protein
STRINGORGLA01G0315200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.16e-44myb domain protein 118